LL-37 is a human antimicrobial peptide belonging to the cathelicidin family and is the only cathelicidin-derived peptide identified in humans. It plays a critical role in innate immunity, exhibiting broad-spectrum antimicrobial activity against bacteria, viruses, and fungi. In addition to its antimicrobial properties, LL-37 is involved in immune modulation, wound healing, and regulation of inflammatory responses, making it widely used in research related to host defense and tissue repair.
$140.00
With extensive experience in compound synthesis, we can provide rapid custom synthesis services for this product according to your research needs.
Questions
LL37 Common Questions
What’s pIC50?
pIC50 is the negative log of the IC50 value when converted to molar.That is, pIC50=-log(IC50).
What’s Kd?
Dissociation consent (Kd) reflects the affinity of a compound for its target. In some cases, it can be equivalent to Ki.
Description
LL-37 is a human antimicrobial peptide belonging to the cathelicidin family and is the only cathelicidin-derived peptide identified in humans. It plays a critical role in innate immunity, exhibiting broad-spectrum antimicrobial activity against bacteria, viruses, and fungi. In addition to its antimicrobial properties, LL-37 is involved in immune modulation, wound healing, and regulation of inflammatory responses, making it widely used in research related to host defense and tissue repair.
Targets & IC50
Targets:
Bacterial Cell Membrane
Formyl Peptide Receptor 2 (FPR2)
Innate Immune Response
NF-κB Signaling Pathway
IC50:
Not applicable (LL-37 acts via membrane disruption and receptor-mediated signaling, not classical inhibition)
In vitro
METHODS: Human keratinocytes, macrophages, and bacterial cultures (e.g., E. coli, S. aureus) were treated with LL-37 (0–50 μM) for 6–48 hours. Antimicrobial activity, cytokine expression, and cell migration were evaluated using MIC assays, ELISA, and wound healing assays.
RESULTS: LL-37 exhibits broad-spectrum antimicrobial activity by disrupting microbial membranes. It modulates immune responses through interaction with receptors such as FPR2 and regulates inflammatory signaling pathways including NF-κB. Additionally, LL-37 promotes wound healing by enhancing keratinocyte migration and angiogenesis. No significant cytotoxicity is observed at controlled experimental concentrations. [1]
Synonyms
Cathelicidin LL-37
Molecular Weight
4493.3 Da
Formula
C₂₀₅H₃₄₀N₆₀O₅₃ (approximate)
Cas No.
154947-66-7
Smiles
Not applicable (peptide)
Relative Density.
Not available
Sequence
LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Sequence Short
37 aa
Storage
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density.
No account yet?
Create an Account