Cagrilintide + Semaglutide
$252.00
With extensive experience in compound synthesis, we can provide rapid custom synthesis services for this product according to your research needs.
Questions
Common Questions
What’s pIC50?
pIC50 is the negative log of the IC50 value when converted to molar.That is, pIC50=-log(IC50).
What’s Kd?
Dissociation consent (Kd) reflects the affinity of a compound for its target. In some cases, it can be equivalent to Ki.
Product Introduction
Bioactivity
Description
Cagrilintide is a long-acting amylin analogue acting as a dual agonist of the amylin receptor and calcitonin receptor, reducing body weight and food intake for obesity research.
Semaglutide is a glucagon-like peptide 1 receptor (GLP-1R) agonist(EC50 of 6.2 pM in a reporter assay using BHK cells expressing the human receptor).
Targets & IC50
Semaglutide: albumin:27 µM, GLP1 receptor:6.2 pM (EC50)
In vitro
Cagrilintide (compound 23) (0.1, 1, 3, 10, and 30 nmol/kg, subcutaneous injection) reduced food intake in rats [2]. Cagrilintide (10 nmol/kg, administered intravenously or subcutaneously) exhibited favorable pharmacokinetic parameters [2].
Chemical Properties
Molecular Weight
Cagrilintide: 4409.01 Semaglutide: 4114
Formula
Cagrilintide: C194H312N54O59S2
Semaglutide: C187H291N45O59
Cas No.
Cagrilintide: 1415456-99-3 Semaglutide: 910463-68-2
Smiles
Semaglutide: CC[C@@H]([C@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC(C(C)(NC([C@@H](N)CC1=CN=CN1)=O)C)=O)CCC(O)=O)=O)=O)[C@H](O)C)=O)CC2=CC=CC=C2)=O)[C@H](O)C)=O)CO)=O)CC(O)=O)=O)C(C)C)=O)CO)=O)CO)=O)CC3=CC=C(O)C=C3)=O)CC(C)C)=O)CCC(O)=O)=O)=O)CCC(N)=O)=O)C)=O)C)=O)CCCCNC(COCCOCCNC(COCCOCCNC(CC[C@@H](NC(CCCCCCCCCCCCCCCCC(O)=O)=O)C(O)=O)=O)=O)=O)=O)CCC(O)=O)=O)CC4=CC=CC=C4)=O)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(NCC(O)=O)=O)CCCNC(N)=N)=O)=O)CCCNC(N)=N)=O)C(C)C)=O)CC(C)C)=O)CC5=CNC6=CC=CC=C65)=O)C)=O)C
Relative Density.
no data available
Sequence
Cagrilintide: {Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge:Cys3-Cys8)
Semaglutide: His-{Aib}-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-{C18 diacid-γ-Glu-(AEEA)2-Lys}-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly
Sequence Short
Cagrilintide: {Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP (Disulfide bridge:Cys3-Cys8)
Semaglutide: {Aib}-EGTFTSDVSSYLEGQAA-{C18 diacid-γ-Glu-(AEEA)2-Lys}-EFIAWLVRGRG
Storage & Solubility Information
Storage
Formula
Solution Preparation Table
H2O
|
1mg |
5mg |
10mg |
||
|---|---|---|---|---|
|
1 mM |
0.2268 mL |
1.1340 mL |
2.2681 mL |
11.3404 mL |
|
5 mM |
0.0454 mL |
0.2268 mL |
0.4536 mL |
2.2681 mL |
|
10 mM |
0.0227 mL |
0.1134 mL |
0.2268 mL |
1.1340 mL |
H2O/H2O/DMSO
|
1mg |
5mg |
10mg |
50mg |
|
|---|---|---|---|---|
|
1 mM |
0.2431 mL |
1.2154 mL |
2.4307 mL |
12.1536 mL |
Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density.
References
- 1. Fontanella RA, et al. Tirzepatide prevents neurodegeneration through multiple molecular pathways. J Transl Med. 2024 Jan 29;22(1):114.
- 2. Weimin K, et al. Tirzepatide as an innovative treatment strategy in a pre-clinical model of obesity-driven endometrial cancer. Gynecologic Oncology. 2024;191:116-123.
- 3. Guo X, et al. Tirzepatide ameliorates spatial learning and memory impairment through modulation of aberrant insulin resistance and inflammation response in diabetic rats. Front Pharmacol. 2023 Aug 28;14:1146960.
